PDB entry 1bx9

View 1bx9 on RCSB PDB site
Description: glutathione s-transferase in complex with herbicide
Class: transferase/peptide
Keywords: HERBICIDE, FOE-4053-glutathione conjugate, product of the detoxifying reaction, TRANSFERASE, TRANSFERASE-PEPTIDE COMPLEX
Deposited on 1998-10-14, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Arabidopsis thaliana [TaxId:3702]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bx9a1, d1bx9a2
  • Chain 'B':
    Compound: FOE-4053-glutathione conjugate GGL-FOE-GLY
    Database cross-references and differences (RAF-indexed):
    • PDB 1BX9 (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bx9A (A:)
    agikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedg
    dlklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafe
    qifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyll
    gtptkklfterprvnewvaeitkrpasekvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bx9A (A:)
    gikvfghpasiatrrvlialheknldfelvhvelkdgehkkepflsrnpfgqvpafedgd
    lklfesraitqyiahryenqgtnllqtdsknisqyaimaigmqvedhqfdpvasklafeq
    ifksiyglttdeavvaeeeaklakvldvyearlkefkylagetftltdlhhipaiqyllg
    tptkklfterprvnewvaeitkrpasekvq
    

  • Chain 'B':
    No sequence available.