PDB entry 1bx8

View 1bx8 on RCSB PDB site
Description: hirustasin from hirudo medicinalis at 1.4 angstroms
Class: anti-coagulant
Keywords: anti-coagulant, peptidic inhibitors, conformational flexibility, serine protease inhibitor
Deposited on 1998-10-14, released 1999-04-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.178
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hirustasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bx8a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bx8A (A:)
    tqgntcggetcsaaqvclkgkcvcnevhcrirckyglkkdengceypcscakasq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bx8A (A:)
    tcggetcsaaqvclkgkcvcnevhcrirckyglkkdengceypcscaka