PDB entry 1bx7

View 1bx7 on RCSB PDB site
Description: hirustasin from hirudo medicinalis at 1.2 angstroms
Class: anti-coagulant
Keywords: anti-coagulant, peptidic inhibitors, conformational flexibility, serine protease inhibitor
Deposited on 1998-10-14, released 1999-04-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.18
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hirustasin
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1bx7a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bx7A (A:)
    tqgntcggetcsaaqvclkgkcvcnevhcrirckyglkkdengceypcscakasq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bx7A (A:)
    gntcggetcsaaqvclkgkcvcnevhcrirckyglkkdengceypcscaka