PDB entry 1bx4

View 1bx4 on RCSB PDB site
Description: structure of human adenosine kinase at 1.50 angstroms
Class: transferase
Keywords: human adenosine kinase, transferase
Deposited on 1998-10-13, released 1999-10-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (adenosine kinase)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bx4a_
  • Heterogens: CL, MG, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bx4A (A:)
    mtsvrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkvey
    haggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqpt
    gtcaacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvl
    kvahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkd
    ikeiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagd
    afvggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bx4A (A:)
    vrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
    gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc
    aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva
    hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike
    iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdafv
    ggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh