PDB entry 1bx3

View 1bx3 on RCSB PDB site
Description: effects of commonly used cryoprotectants on glycogen phosphorylase activity and structure
Class: transferase
Keywords: phosphorylase, inhibitor, cryoprotectant, mpd, dmso, cryocrystallography, transferase
Deposited on 1999-10-13, released 1998-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glycogen phosphorylase b)
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00489
      • see remark 999 (379)
      • see remark 999 (608)
    Domains in SCOPe 2.07: d1bx3a_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bx3A (A:)
    srplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvr
    dhlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldme
    eleeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeead
    dwlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvnt
    mrlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvv
    aatlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerld
    wdkawevtvktcaytnhtvipealerwpvhlletllprhlqiiyeinqrflnrvaaafpg
    dvdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfq
    nktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqe
    nklkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvp
    rtvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaa
    dlseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdr
    ldqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeey
    vkcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdek
    ip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bx3A (A:)
    isvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtqq
    hyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedaglg
    ngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpweka
    rpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapgyi
    qavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksnfdafpdkva
    iqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvipealerwpvhllet
    llprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlciagshavng
    varihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaerigeeyisd
    ldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvqvkriheyk
    rqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitaigdvvnhdp
    vvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlngaltigtmdg
    anvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqlssgffspkq
    pdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirniatsgkfssd
    rtiaqyareiwgvepsrqrlp