PDB entry 1bx1

View 1bx1 on RCSB PDB site
Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312q
Class: oxidoreductase
Keywords: flavoprotein, oxidoreductase
Deposited on 1998-10-10, released 1998-10-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin:nadp+ oxidoreductase)
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00455 (Start-313)
      • mutation (311)
    Domains in SCOPe 2.06: d1bx1a1, d1bx1a2
  • Heterogens: PO4, SO4, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bx1A (A:)
    qiasdveapppapakvekhskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhm
    vfshegeipyregqsvgvipdgedkngkphklrlysiassalgdfgdaksvslcvkrliy
    tndagetikgvcsnflcdlkpgaevkltgpvgkemlmpkdpnatiimlgtgtgiapfrsf
    lwkmffekhddykfnglawlflgvptsssllykeefekmkekapdnfrldfavsreqtne
    kgekmyiqtrmaqyavelwemlkkdntyfymcglkgmekgiddimvslaaaegidwieyk
    rqlkkaeqwnvqvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bx1A (A:)
    hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
    ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
    lkpgaevkltgpvgkemlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfngla
    wlflgvptsssllykeefekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavel
    wemlkkdntyfymcglkgmekgiddimvslaaaegidwieykrqlkkaeqwnvqvy