PDB entry 1bx0

View 1bx0 on RCSB PDB site
Description: ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l
Deposited on 1998-10-10, released 1998-10-14
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-22, with a file datestamp of 1999-12-21.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bx0A (A:)
    hskkmeegitvnkfkpktpyvgrcllntkitgddapgetwhmvfshegeipyregqsvgv
    ipdgedkngkphklrlysiassalgdfgdaksvslcvkrliytndagetikgvcsnflcd
    lkpgaevkltgpvgkemlmpkdpnatiimlgtgtgiapfrsflwkmffekhddykfngla
    wlflgvptsssllykeefekmkekapdnfrldfavsreqtnekgekmyiqtrmaqyavel
    wemlkkdntyfymcglkgmekgiddimvslaaaegidwieykrqlkkaeqwnvlvy