PDB entry 1bwz

View 1bwz on RCSB PDB site
Description: diaminopimelate epimerase from hemophilus influenzae
Class: isomerase
Keywords: metabolic role, structural classification
Deposited on 1998-09-29, released 1998-12-16
The last revision prior to the SCOP 1.73 freeze date was dated 1999-12-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: 0.19
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (diaminopimelate epimerase)
    Species: Haemophilus influenzae
    Gene: DAPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44859 (0-273)
      • conflict (110)
    Domains in SCOP 1.73: d1bwza1, d1bwza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bwzA (A:)
mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkdmnqirvnmge
piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
sherfpervnagfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqv
dlpggslmiewngvghplymtgeathiydgfitl