PDB entry 1bwz

View 1bwz on RCSB PDB site
Description: diaminopimelate epimerase from hemophilus influenzae
Class: isomerase
Keywords: metabolic role, structural classification, isomerase
Deposited on 1998-09-29, released 1998-12-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (diaminopimelate epimerase)
    Species: Haemophilus influenzae [TaxId:727]
    Gene: DAPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P44859 (0-273)
      • conflict (110)
    Domains in SCOPe 2.07: d1bwza1, d1bwza2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwzA (A:)
    mqfskmhglgndfvvvdgvtqnvfftpetirrlanrhcgigfdqlliveapydpeldfhy
    rifnadgsevsqcgngarcfarfvtlkgltnkkdisvstqkgnmvltvkdmnqirvnmge
    piwepakipftankfeknyilrtdiqtvlcgavsmgnphcvvqvddiqtanveqlgplle
    sherfpervnagfmqiinkehiklrvyergagetqacgsgacaavavgimqgllnnnvqv
    dlpggslmiewngvghplymtgeathiydgfitl