PDB entry 1bwy

View 1bwy on RCSB PDB site
Description: nmr study of bovine heart fatty acid binding protein
Class: lipid binding protein
Keywords: intracellular lipid binding protein, fatty acid binding, heart muscle, fatty acid binding protein, lipid binding protein
Deposited on 1998-09-29, released 1998-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (heart fatty acid binding protein)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10790 (0-131)
  Domains in SCOPe 2.08: d1bwya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwyA (A:)
  vdafvgtwklvdsknfddymkslgvgfatrqvgnmtkpttiievngdtviiktqstfknt
  eisfklgvefdettaddrkvksivtldggklvhvqkwngqetslvremvdgkliltlthg
  tavctrtyekqa