PDB entry 1bwx

View 1bwx on RCSB PDB site
Description: the solution structure of human parathyroid hormone fragment 1-39, nmr, 10 structures
Class: peptide hormone
Keywords: peptide hormone, solution structure, human parathyroid hormone
Deposited on 1998-09-29, released 2000-01-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parathyroid hormone
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01270 (0-38)
  Domains in SCOPe 2.01: d1bwxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwxA (A:)
  svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalga