PDB entry 1bwx

View 1bwx on RCSB PDB site
Description: the solution structure of human parathyroid hormone fragment 1-39, nmr, 10 structures
Class: peptide hormone
Keywords: peptide hormone, solution structure, human parathyroid hormone
Deposited on 1998-09-29, released 2000-01-14
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parathyroid hormone
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01270 (0-38)
  Domains in SCOP 1.75: d1bwxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwxA (A:)
  svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalga