PDB entry 1bwx

View 1bwx on RCSB PDB site
Description: the solution structure of human parathyroid hormone fragment 1-39, nmr, 10 structures
Class: peptide hormone
Keywords: peptide hormone, solution structure, human parathyroid hormone
Deposited on 1998-09-29, released 2000-01-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parathyroid hormone
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bwxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwxA (A:)
    svseiqlmhnlgkhlnsmervewlrkklqdvhnfvalga