PDB entry 1bww

View 1bww on RCSB PDB site
Description: bence-jones immunoglobulin rei variable portion, t39k mutant
Class: immune system
Keywords: reiv, stabilized immunoglobulin fragment, bence-jones protein, immune system
Deposited on 1998-09-29, released 1998-10-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ig kappa chain v-I region rei)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01607 (2-108)
      • conflict (0-1)
      • engineered (40)
    Domains in SCOPe 2.06: d1bwwa_
  • Chain 'B':
    Compound: protein (ig kappa chain v-I region rei)
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01607 (2-108)
      • conflict (0-1)
      • engineered (40)
    Domains in SCOPe 2.06: d1bwwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwwA (A:)
    tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwwB (B:)
    tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit