PDB entry 1bww

View 1bww on RCSB PDB site
Description: bence-jones immunoglobulin rei variable portion, t39k mutant
Class: immune system
Keywords: reiv, stabilized immunoglobulin fragment, bence-jones protein
Deposited on 1998-09-29, released 1998-10-07
The last revision prior to the SCOP 1.75 freeze date was dated 2004-01-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ig kappa chain v-I region rei)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01607 (2-108)
      • conflict (0-1)
      • engineered (40)
    Domains in SCOP 1.75: d1bwwa_
  • Chain 'B':
    Compound: protein (ig kappa chain v-I region rei)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01607 (2-108)
      • conflict (0-1)
      • engineered (40)
    Domains in SCOP 1.75: d1bwwb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwwA (A:)
    tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwwB (B:)
    tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
    psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit