PDB entry 1bww
View 1bww on RCSB PDB site
Description: bence-jones immunoglobulin rei variable portion, t39k mutant
Class: immune system
Keywords: reiv, stabilized immunoglobulin fragment, bence-jones protein, immune system
Deposited on
1998-09-29, released
1998-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.182
AEROSPACI score: 0.56
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (ig kappa chain v-I region rei)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01607 (2-108)
- conflict (0-1)
- engineered (40)
Domains in SCOPe 2.08: d1bwwa_ - Chain 'B':
Compound: protein (ig kappa chain v-I region rei)
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot P01607 (2-108)
- conflict (0-1)
- engineered (40)
Domains in SCOPe 2.08: d1bwwb_ - Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1bwwA (A:)
tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1bwwB (B:)
tpdiqmtqspsslsasvgdrvtitcqasqdiikylnwyqqkpgkapklliyeasnlqagv
psrfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit