PDB entry 1bwv

View 1bwv on RCSB PDB site
Description: Activated Ribulose 1,5-Bisphosphate Carboxylase/Oxygenase (RUBISCO) Complexed with the Reaction Intermediate Analogue 2-Carboxyarabinitol 1,5-Bisphosphate
Deposited on 1998-09-29, released 1999-09-27
The last revision prior to the SCOP 1.55 freeze date was dated 1999-09-27, with a file datestamp of 1999-09-26.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.163
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvA (A:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvC (C:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvE (E:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvG (G:)
    riknsryesgvipyakmgywnpdyqvkdtdvlalfrvtpqpgvdpieaaaavagesstat
    wtvvwtdlltaadlyrakaykvdqvpnnpeqyfayiayeldlfeegsianltasiignvf
    gfkavkalrledmrlplaylktfqgpatgvilererldkfgrpllgcttkpklglsgkny
    grvvyealkggldfvkddeninsqpfmrwrerylftmeavnkasaatgevkghylnvtaa
    tmeemyaranfakelgsviimidlvigytaiqtmakwardndmilhlhragnstysrqkn
    hgmnfrvickwmrmagvdhihagtvvgklegdpiitrgfyktlllpklernlqeglffdm
    ewaslrkvmpvasggihagqmhqlihylgedvvlqfgggtighpdgiqagatanrvalea
    milarnenrdyltegpeilreaaktcgalrtaldlwkditfnytstdtsdfv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvS (S:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvU (U:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvW (W:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery
    

  • Chain 'Y':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwvY (Y:)
    vritqgtfsflpdltdeqikkqidymiskklaigieytndihprnayweiwglplfdvtd
    paavlfeinacrkarsnfyikvvgfssvrgiestiisfivnrpkhepgfnlmrqedksrs
    ikytihsyesykpedery