PDB entry 1bwu

View 1bwu on RCSB PDB site
Description: mannose-specific agglutinin (lectin) from garlic (allium sativum) bulbs complexed with alpha-d-mannose
Class: plant protein
Keywords: bulb lectin, mannose, plant protein
Deposited on 1998-09-28, released 1999-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (agglutinin)
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38789 (0-105)
      • conflict (11)
      • conflict (18)
      • conflict (38)
      • conflict (45)
      • conflict (47)
      • conflict (53)
      • conflict (98)
      • conflict (105)
    Domains in SCOPe 2.07: d1bwua_
  • Chain 'D':
    Compound: protein (agglutinin)
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38784 (0-108)
      • conflict (4)
      • conflict (11)
      • conflict (18)
      • conflict (41)
      • conflict (70)
      • conflict (98)
      • conflict (108)
    Domains in SCOPe 2.07: d1bwud_
  • Chain 'P':
    Compound: protein (agglutinin)
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38789 (0-105)
      • conflict (4)
      • conflict (18)
      • conflict (22)
      • conflict (38)
      • conflict (45)
      • conflict (47)
      • conflict (58)
    Domains in SCOPe 2.07: d1bwup_
  • Chain 'Q':
    Compound: protein (agglutinin)
    Species: Allium sativum [TaxId:4682]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38784 (0-108)
      • conflict (4)
      • conflict (18)
      • conflict (41)
      • conflict (70)
    Domains in SCOPe 2.07: d1bwuq_
  • Heterogens: MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwuA (A:)
    rnilrndeglyggqsldvnpyhfimqedcnlvlydhstsvwasntgilgkkgcravlqsd
    gnfvvydaegrslwashsvrgngnyvlvlqedgnvviyrsdiwstn
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwuD (D:)
    rniltndeglyggqsldvnpyhlimqedcnlvlydhstavwssntdipgkkgckavlqsd
    gnfvvydaegaslwashsvrgngnyvlvlqedgnvviyrsdiwstntyr
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwuP (P:)
    rniltndeglyagqsldvnpyhfimqedcnlvlydhstsvwasntgilgkkgckavlqad
    gnfvvydaegrslwashsvrgngnyvlvlqedgnvviygsdiwstn
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwuQ (Q:)
    rniltndeglyagqsldvnpyhlimqedcnlvlydhstavwssntdipgkkgckavlqsd
    gnfvvydaegaslwashsvrgngnyvlvlqedgnvviygsdiwstntyk