PDB entry 1bws

View 1bws on RCSB PDB site
Description: crystal structure of GDP-4-keto-6-deoxy-d-mannose epimerase/reductase from escherichia coli a key enzyme in the biosynthesis of GDP-l-fucose
Class: oxidoreductase
Keywords: epimerase/reductase, GDP-l-fucose biosynthesis, oxidoreductase
Deposited on 1998-09-25, released 1999-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GDP-4-keto-6-deoxy-d-mannose epimerase/reductase)
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32055
      • conflict (254)
    Domains in SCOPe 2.07: d1bwsa_
  • Heterogens: NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bwsA (A:)
    mskqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvy
    laaakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpma
    esellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshv
    ipallrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpml
    shinvgtgvdctirdlaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheis
    leaglastyqwflenqdrfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwsA (A:)
    kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
    aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
    ellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
    allrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
    invgtgvdctirdlaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
    aglastyqwflenq