PDB entry 1bwr

View 1bwr on RCSB PDB site
Description: probing the substrate specificity of the intracellular brain platelet-activating factor acetylhydrolase
Class: hydrolase
Keywords: acetylhydrolase
Deposited on 1998-09-27, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.205
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q29460
      • engineered (102)
    Domains in SCOPe 2.07: d1bwra_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bwrA (A:)
    msgdenpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwre
    lfsplhalnfgiggdstqhvlwrlengelehirpkivvvwvgsnnhghtaeqvtggikai
    vqlvnerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvh
    sdgtishhdmydylhlsrlgytpvcralhslllrlltqdqgqggaplpepspp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwrA (A:)
    enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
    lhalnfgiggdstqhvlwrlengelehirpkivvvwvgsnnhghtaeqvtggikaivqlv
    nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
    ishhdmydylhlsrlgytpvcralhslllrll