PDB entry 1bwo

View 1bwo on RCSB PDB site
Description: the crystal structure of wheat non-specific transfer protein complexed with two molecules of phospholipid at 2.1 a resolution
Class: lipid transfer protein
Keywords: lipid transfer protein, wheat, lipid binding
Deposited on 1998-09-25, released 1999-08-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nonspecific lipid-transfer protein
  Species: Triticum aestivum [TaxId:4565]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24296 (0-89)
  Domains in SCOPe 2.08: d1bwoa_
• Chain 'B':
  Compound: nonspecific lipid-transfer protein
  Species: Triticum aestivum [TaxId:4565]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24296 (0-89)
  Domains in SCOPe 2.08: d1bwob_
• Heterogens: LPC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwoA (A:)
  idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
  lnednarsippkcgvnlpytislnidcsrv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bwoB (B:)
  idcghvdslvrpclsyvqggpgpsgqccdgvknlhnqarsqsdrqsacnclkgiargihn
  lnednarsippkcgvnlpytislnidcsrv