PDB entry 1bwn

View 1bwn on RCSB PDB site
Description: ph domain and btk motif from bruton's tyrosine kinase mutant e41k in complex with ins(1,3,4,5)p4
Class: transferase
Keywords: transferase, ph domain, btk motif, inositol-(1,3,4,5)-tetrakisphosphate, zinc binding, x-linked agammaglobulinemia, tyrosine-protein kinase
Deposited on 1998-09-25, released 1999-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bruton's tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187 (0-168)
      • engineered (39)
    Domains in SCOPe 2.07: d1bwna_
  • Chain 'B':
    Compound: bruton's tyrosine kinase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06187 (0-168)
      • engineered (39)
    Domains in SCOPe 2.07: d1bwnb_
  • Heterogens: ZN, 4IP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bwnA (A:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwnA (A:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgsemeqisiierfpypfqvvydegplyvfspteelrkrw
    ihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bwnB (B:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
    tcvetvvpeknppperqiprrgeessemeqisiierfpypfqvvydegplyvfspteelr
    krwihqlknvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwnB (B:)
    aavilesiflkrsqqkkktsplnfkkrlflltvhklsyykydfergrrgskkgsidveki
    tcvetvvpeknppperqiemeqisiierfpypfqvvydegplyvfspteelrkrwihqlk
    nvirynsdlvqkyhpcfwidgqylccsqtaknamgcqilen