PDB entry 1bwm

View 1bwm on RCSB PDB site
Description: a single-chain t cell receptor
Class: immune system
Keywords: immunoglobulin, immunoreceptor, immune system
Deposited on 1998-09-23, released 1999-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-beta t cell receptor (tcr) (d10))
    Species: Mus musculus, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB U83243 (0-108)
      • engineered (246)
    • GB U83242 (137-248)
    Domains in SCOPe 2.07: d1bwma1, d1bwma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwmA (A:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgsdykddddk
    rsggggsggggsggsgaqqqvrqspqsltvwegettilncsyedstfdyfpwyrqfpgks
    palliaislvsnkkedgrftiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfga
    gtrlavspy