PDB entry 1bwf

View 1bwf on RCSB PDB site
Description: escherichia coli glycerol kinase mutant with bound ATP analog showing substantial domain motion
Class: transferase
Keywords: transferase, kinase, domain motion, allosteric regulation hydrolase, lipid degradation, platelet factor,
Deposited on 1998-09-23, released 1999-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.168
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: glycerol kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F3
      • engineered (57)
    Domains in SCOPe 2.07: d1bwfo1, d1bwfo2
  • Chain 'Y':
    Compound: glycerol kinase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6F3
      • engineered (57)
    Domains in SCOPe 2.07: d1bwfy1, d1bwfy2
  • Heterogens: MG, ATF, GOL

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1bwfO (O:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqswtl
    vevlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwfO (O:)
    ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqswtlv
    evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
    dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
    dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtnigtripisgiagd
    qqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalega
    vfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaif
    gltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdi
    lgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryag
    wkkavkramaweeh
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1bwfY (Y:)
    tekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqswtl
    vevlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgl
    edyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhv
    tdytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripis
    giagdqqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevny
    alegavfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpya
    rgaifgltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmq
    fqsdilgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgiettern
    yryagwkkavkramaweehde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bwfY (Y:)
    ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqswtlv
    evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
    dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
    dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtnigtripisgiagd
    qqaalfgqlcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalega
    vfmagasiqwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaif
    gltrgvnanhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdi
    lgtrverpevrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryag
    wkkavkramaweeh