PDB entry 1bwa

View 1bwa on RCSB PDB site
Description: hiv-1 protease (v82f/i84v) double mutant complexed with xv638 of dupont pharmaceuticals
Class: hydrolase
Keywords: hiv-1 protease, hydrolase
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (hiv-1 protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1bwaa_
  • Chain 'B':
    Compound: protein (hiv-1 protease)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (81)
      • engineered (83)
    Domains in SCOPe 2.08: d1bwab_
  • Heterogens: XV6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwaA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfnvigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bwaB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpfnvigrnlltqigctlnf