PDB entry 1bw8

View 1bw8 on RCSB PDB site
Description: mu2 adaptin subunit (ap50) of ap2 adaptor (second domain), complexed with egfr internalization peptide fyralm
Class: peptide binding protein
Keywords: endocytosis, adaptor, peptide complex, peptide binding protein
Deposited on 1998-09-30, released 1998-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.272
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (mu2 adaptin subunit)
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bw8a_
  • Chain 'P':
    Compound: protein (internalization signal from egfr)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1BW8 (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bw8A (A:)
    mhhhhhhqnsetgalktfitqqgiksqhqtkeeqsqitsqvtgqigwrregikyrrnelf
    ldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmndkiviekqgkgtadets
    ksgkqsiaiddctfhqcvrlskfdsersisfippdgefelmryrttkdiilpfrviplvr
    evgrtklevkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwk
    ikrmagmkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnys
    dhdvikwvryigrsgiyetrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bw8A (A:)
    igwrregikyrrnelfldvlesvnllmspqgqvlsahvsgrvvmksylsgmpeckfgmnd
    kikqsiaiddctfhqcvrlsersisfippdgefelmryrttkdiilpfrviplvrevgrt
    klevkvviksnfkpsllaqkievriptplntsgvqvicmkgkakykasenaivwkikrma
    gmkesqisaeiellptndkkkwarppismnfevpfapsglkvrylkvfepklnysdhdvi
    kwvryigrsgiyetrc
    

  • Chain 'P':
    No sequence available.