PDB entry 1bw6

View 1bw6 on RCSB PDB site
Description: human centromere protein b (cenp-b) DNA bindign domain rp1
Class: DNA binding protein
Keywords: CENTROMERE PROTEIN, DNA-BINDING, HELIX-TURN-HELIX, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, DNA BINDING PROTEIN
Deposited on 1998-09-30, released 1998-10-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (centromere protein b)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bw6a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bw6A (A:)
    mgpkrrqltfreksriiqeveenpdlrkgeiarrfnippstlstilknkrailase