PDB entry 1bw5

View 1bw5 on RCSB PDB site
Description: the nmr solution structure of the homeodomain of the rat insulin gene enhancer protein isl-1, 50 structures
Class: DNA-binding protein
Keywords: DNA-binding protein, homeodomain, lim domain
Deposited on 1998-09-29, released 1999-06-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin gene enhancer protein isl-1
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50480 (1-65)
      • conflict (60)
      • conflict (63)
    Domains in SCOPe 2.01: d1bw5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bw5A (A:)
    mkttrvrtvlnekqlhtlrtcyaanprpdalmkeqlvemtglsprvirvwfqnkrckdkk
    rsimmk