PDB entry 1bw4

View 1bw4 on RCSB PDB site
Description: three-dimensional structure in solution of barwin, a protein from barley seed
Deposited on 1992-07-06, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1bw4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bw4_ (-)
    eqandvratyhyyrpaqnnwdlgapavsaycatwdaskplswrskygwtafcgpagprgq
    aacgkclrvtnpatgaqitarivdqcanggldldwdtvftkidtngigyqqghlnvnyqf
    vdcrd