PDB entry 1bw0

View 1bw0 on RCSB PDB site
Description: crystal structure of tyrosine aminotransferase from trypanosoma cruzi
Deposited on 1998-09-28, released 1999-09-27
The last revision prior to the SCOP 1.71 freeze date was dated 1999-11-18, with a file datestamp of 1999-11-17.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.157
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1bw0a_
  • Chain 'B':
    Domains in SCOP 1.71: d1bw0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bw0A (A:)
    msswdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklk
    eaidsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilma
    itaicdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktkl
    livtnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfe
    ttvprvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalg
    eallntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdikt
    dveffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bw0A (A:)
    wdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklkeai
    dsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilmaita
    icdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktklliv
    tnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfettv
    prvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalgeal
    lntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdiktdve
    ffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bw0B (B:)
    msswdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklk
    eaidsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilma
    itaicdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktkl
    livtnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfe
    ttvprvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalg
    eallntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdikt
    dveffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bw0B (B:)
    wdvsmsnhaglvfnpirtvsdnakpspspkpiiklsvgdptldknlltsaaqikklkeai
    dsqecngyfptvgspeareavatwwrnsfvhkeelkstivkdnvvlcsggshgilmaita
    icdagdyalvpqpgfphyetvckaygigmhfyncrpendweadldeirrlkddktklliv
    tnpsnpcgsnfsrkhvedivrlaeelrlplfsdeiyagmvfkgkdpnatftsvadfettv
    prvilggtaknlvvpgwrlgwllyvdphgngpsfleglkrvgmlvcgpctvvqaalgeal
    lntpqehldqivakieesamylynhigeciglaptmprgamylmsridlekyrdiktdve
    ffeklleeenvqvlpgtifhapgftrltttrpvevyreaverikafcqrhaav