PDB entry 1bvz

View 1bvz on RCSB PDB site
Description: alpha-amylase II (tvaii) from thermoactinomyces vulgaris r-47
Class: hydrolase
Keywords: hydrolase
Deposited on 1998-09-22, released 1999-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (alpha-amylase II)
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvza1, d1bvza2, d1bvza3
  • Chain 'B':
    Compound: protein (alpha-amylase II)
    Species: Thermoactinomyces vulgaris [TaxId:2026]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvzb1, d1bvzb2, d1bvzb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvzA (A:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvzB (B:)
    mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
    gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse
    vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
    yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
    vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
    pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
    gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
    dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
    rglfefykelirlrhrlasltrgnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqt
    vllqvpesggktwldcltgeevhgkqgqlkltlrpyqgmilwngr