PDB entry 1bvy

View 1bvy on RCSB PDB site
Description: complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
Deposited on 1998-09-21, released 1999-02-23
The last revision prior to the SCOP 1.57 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.1872
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1bvya_
  • Chain 'B':
    Domains in SCOP 1.57: d1bvyb_
  • Chain 'F':
    Domains in SCOP 1.57: d1bvyf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvyA (A:)
    lntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacdesrfdknlsqalkfvr
    dfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiavqlvqkwerlnadehi
    evpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeamnklqranpddpayd
    enkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryqii
    tfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvln
    ealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperf
    enpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketltl
    kpegfvvkakskkiplggi
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvyB (B:)
    ntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacdesrfdknlsqalkfvrd
    fagdglftswtheknwkkahnillpsfsqqamkgyhammvdiavqlvqkwerlnadehie
    vpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeamnklqranpddpayde
    nkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryqiit
    fliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvlne
    alrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperfe
    npsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketltlk
    pegfvvkakskkiplggi
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvyF (F:)
    ntpllvlygsnmgtaegtardladiamskgfapqvatldshagnlpregavlivtasyng
    hppdnakqfvdwldqasadevkgvrysvfgcgdknwattyqkvpafidetlaakgaenia
    drgeadasddfegtyeewrehmwsdvaayfnl