PDB entry 1bvy

View 1bvy on RCSB PDB site
Description: complex of the heme and fmn-binding domains of the cytochrome p450(bm-3)
Class: oxidoreductase
Keywords: fatty acid monooxygenase, hemoprotein, flavoprotein, electron transfer, oxidoreductase
Deposited on 1998-09-21, released 1999-02-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.187
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytochrome p450 bm-3)
    Species: Bacillus megaterium, synthetic [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvya_
  • Chain 'B':
    Compound: protein (cytochrome p450 bm-3)
    Species: Bacillus megaterium, synthetic [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvyb_
  • Chain 'F':
    Compound: protein (cytochrome p450 bm-3)
    Species: Bacillus megaterium, synthetic [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvyf_
  • Heterogens: HEM, FMN, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bvyA (A:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvyA (A:)
    lntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacdesrfdknlsqalkfvr
    dfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiavqlvqkwerlnadehi
    evpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeamnklqranpddpayd
    enkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryqii
    tfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvln
    ealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperf
    enpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketltl
    kpegfvvkakskkiplggi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bvyB (B:)
    tikempqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlike
    acdesrfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammv
    diavqlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvra
    ldeamnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlng
    kdpetgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvd
    pvpsykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipql
    hrdktiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkh
    fdfedhtnyeldiketltlkpegfvvkakskkiplggi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvyB (B:)
    ntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacdesrfdknlsqalkfvrd
    fagdglftswtheknwkkahnillpsfsqqamkgyhammvdiavqlvqkwerlnadehie
    vpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldeamnklqranpddpayde
    nkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryqiit
    fliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmvlne
    alrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrperfe
    npsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketltlk
    pegfvvkakskkiplggi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bvyF (F:)
    pspsteqsakkvrkkaenahntpllvlygsnmgtaegtardladiamskgfapqvatlds
    hagnlpregavlivtasynghppdnakqfvdwldqasadevkgvrysvfgcgdknwatty
    qkvpafidetlaakgaeniadrgeadasddfegtyeewrehmwsdvaayfnldiensedn
    kstlslqfvds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvyF (F:)
    ntpllvlygsnmgtaegtardladiamskgfapqvatldshagnlpregavlivtasyng
    hppdnakqfvdwldqasadevkgvrysvfgcgdknwattyqkvpafidetlaakgaenia
    drgeadasddfegtyeewrehmwsdvaayfnl