PDB entry 1bvw

View 1bvw on RCSB PDB site
Description: cellobiohydrolase ii (cel6a) from humicola insolens
Deposited on 1998-09-19, released 1999-09-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-10-29, with a file datestamp of 1999-10-28.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.142
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1bvwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvwA (A:)
    gnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllvq
    tlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrirei
    lisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymdag
    hagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpnyd
    ekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantghq
    yvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanppf