PDB entry 1bvw

View 1bvw on RCSB PDB site
Description: cellobiohydrolase II (cel6a) from humicola insolens
Class: hydrolase
Keywords: cellulose degradation, cellobiohydrolase, cellulase, glycoside hydrolase family 6, hydrolase
Deposited on 1998-09-19, released 1999-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cellobiohydrolase II)
    Species: Humicola insolens [TaxId:34413]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bvwa_
  • Heterogens: MAN, NAG, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvwA (A:)
    gnpfegvqlwannyyrsevhtlaipqitdpalraaasavaevpsfqwldrnvtvdtllvq
    tlseireanqaganpqyaaqivvydlpdrdcaaaasngewaianngvnnykayinrirei
    lisfsdvrtilviepdslanmvtnmnvpkcsgaastyreltiyalkqldlphvamymdag
    hagwlgwpaniqpaaelfakiyedagkpravrglatnvanynawsvsspppytspnpnyd
    ekhyieafrplleargfpaqfivdqgrsgkqptgqkewghwcnaigtgfgmrptantghq
    yvdafvwvkpggecdgtsdttaarydyhcgledalkpapeagqwfneyfiqllrnanppf