PDB entry 1bvv

View 1bvv on RCSB PDB site
Description: sugar ring distortion in the glycosyl-enzyme intermediate of a family g/11 xylanase
Class: hydrolase
Keywords: xylanase, glycosidase, glycosyl-enzyme intermediate, boat conformation, hydrolase, xylan degradation
Deposited on 1998-09-18, released 1999-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: endo-1,4-beta-xylanase
  Species: Bacillus circulans [TaxId:1397]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P09850 (0-184)
  Domains in SCOPe 2.08: d1bvva_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1bvvA (A:)
  astdywqnwtdgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
  ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
  drttftqywsvrqskrptgsnatitftnhvnawkshgmnlgsnwayqvmategyqssgss
  nvtvw