PDB entry 1bvt

View 1bvt on RCSB PDB site
Description: metallo-beta-lactamase from bacillus cereus 569/h/9
Class: hydrolase
Keywords: hydrolase (beta-lactamase), metallo beta-lactamase, zinc
Deposited on 1998-09-18, released 1998-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.222
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (beta-lactamase)
    Species: Bacillus cereus [TaxId:1396]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvta_
  • Heterogens: ZN, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bvtA (A:)
    sqkvektviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswd
    dkltkeliemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngy
    eeplgdlqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgn
    vadayvnewstsienvlkryrninavvpghgevgdkglllhtldllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvtA (A:)
    tviknetgtisisqlnknvwvhtelgsfngeavpsnglvlntskglvlvdsswddkltke
    liemvekkfqkrvtdviithahadriggiktlkergikahstaltaelakkngyeeplgd
    lqtvtnlkfgnmkvetfypgkghtednivvwlpqynilvggclvkstsakdlgnvadayv
    newstsienvlkryrninavvpghgevgdkglllhtldllk