PDB entry 1bvs

View 1bvs on RCSB PDB site
Description: ruva complexed to a holliday junction.
Deposited on 1998-09-17, released 1998-09-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.274
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bvsA (A:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsA (A:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bvsB (B:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsB (B:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bvsC (C:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsC (C:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bvsD (D:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsD (D:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bvsE (E:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsE (E:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bvsF (F:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsF (F:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bvsG (G:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsG (G:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bvsH (H:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsH (H:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr