PDB entry 1bvs

View 1bvs on RCSB PDB site
Description: ruva complexed to a holliday junction.
Class: DNA binding protein
Keywords: holliday junction resolvase component, branch migration, DNA repair, DNA binding protein
Deposited on 1998-09-17, released 1998-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.274
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvsa1, d1bvsa2, d1bvsa3
  • Chain 'B':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvsb1, d1bvsb2, d1bvsb3
  • Chain 'C':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvsc1, d1bvsc2, d1bvsc3
  • Chain 'D':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvsd1, d1bvsd2, d1bvsd3
  • Chain 'E':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvse1, d1bvse2, d1bvse3
  • Chain 'F':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvsf1, d1bvsf2, d1bvsf3
  • Chain 'G':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvsg1, d1bvsg2, d1bvsg3
  • Chain 'H':
    Compound: protein (holliday junction DNA helicase ruva)
    Species: Mycobacterium leprae [TaxId:1769]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40832 (0-202)
      • conflict (38)
      • conflict (116)
    Domains in SCOPe 2.07: d1bvsh1, d1bvsh2, d1bvsh3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bvsA (A:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsA (A:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1bvsB (B:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsB (B:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bvsC (C:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsC (C:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1bvsD (D:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsD (D:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1bvsE (E:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsE (E:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1bvsF (F:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsF (F:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1bvsG (G:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsG (G:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1bvsH (H:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpvgasgltvgtaadgnavrgsvvealvglgfaakqaeeatdqvldgel
    gkdgavatssalraalsllgktr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvsH (H:)
    mifsvrgevlevaldhavieaagigyrvnatpsalatlnqgsqarlvtamvvredsmtly
    gfsdaenrdlflallsvsgvgprlamatlavhdaaalrqaladsdvasltrvpgigrrga
    erivleladkvgpgnavrgsvvealvglgfaakqaeeatdqvldgeatssalraalsllg
    ktr