PDB entry 1bvr

View 1bvr on RCSB PDB site
Description: m.tb. enoyl-acp reductase (inha) in complex with nad+ and c16-fatty-acyl-substrate
Class: oxidoreductase
Keywords: NADH-DEPENDENT ENOYL-ACP REDUCTASE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, OXIDOREDUCTASE
Deposited on 1998-09-17, released 1999-09-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.217
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (enoyl-acyl carrier protein (acp) reductase)
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bvra_
  • Chain 'B':
    Compound: protein (enoyl-acyl carrier protein (acp) reductase)
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bvrb_
  • Chain 'C':
    Compound: protein (enoyl-acyl carrier protein (acp) reductase)
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bvrc_
  • Chain 'D':
    Compound: protein (enoyl-acyl carrier protein (acp) reductase)
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bvrd_
  • Chain 'E':
    Compound: protein (enoyl-acyl carrier protein (acp) reductase)
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bvre_
  • Chain 'F':
    Compound: protein (enoyl-acyl carrier protein (acp) reductase)
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1bvrf_
  • Heterogens: NAD, THT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvrA (A:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvrB (B:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvrC (C:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvrD (D:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvrE (E:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvrF (F:)
    tglldgkrilvsgiitdssiafhiarvaqeqgaqlvltgfdrlrliqritdrlpakapll
    eldvqneehlaslagrvteaigagnkldgvvhsigfmpqtgmginpffdapyadvskgih
    isaysyasmakallpimnpggsivgmdfdpsrampaynwmtvaksalesvnrfvareagk
    ygvrsnlvaagpirtlamsaivggalgeeagaqiqlleegwdqrapigwnmkdatpvakt
    vcallsdwlpattgdiiyadggahtqll