PDB entry 1bvq

View 1bvq on RCSB PDB site
Description: three-dimensional structure of 4-hydroxybenzoyl coa thioesterase from pseudomonas sp. strain cbs-3.
Class: hydrolase
Keywords: hydrolase
Deposited on 1998-09-16, released 1998-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (4-hydroxybenzoyl coa thioesterase)
    Species: Pseudomonas sp. CBS3 [TaxId:72586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56653
      • conflict (23)
    Domains in SCOPe 2.07: d1bvqa_
  • Heterogens: EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bvqA (A:)
    marsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtp
    ivscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfa
    mndgerlraievpadyielcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvqA (A:)
    arsitmqqriefgdcdpagivwypnyhrwldaasrnyfikcglppwrqtvvergivgtpi
    vscnasfvctasyddvltietcikewrrksfvqrhsvsrttpggdvqlvmradeirvfam
    ndgerlraievpadyielc