PDB entry 1bvp

View 1bvp on RCSB PDB site
Description: the crystal structure of bluetongue virus vp7
Class: Viral protein
Keywords: VIRUS, VP7, TRIMER, Viral protein
Deposited on 1995-02-17, released 1995-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.184
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: bluetongue virus coat protein vp7
    Species: Bluetongue virus [TaxId:10900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvp11, d1bvp12
  • Chain '2':
    Compound: bluetongue virus coat protein vp7
    Species: Bluetongue virus [TaxId:10900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvp21, d1bvp22
  • Chain '3':
    Compound: bluetongue virus coat protein vp7
    Species: Bluetongue virus [TaxId:10900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvp31, d1bvp32
  • Chain '4':
    Compound: bluetongue virus coat protein vp7
    Species: Bluetongue virus [TaxId:10900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvp41, d1bvp42
  • Chain '5':
    Compound: bluetongue virus coat protein vp7
    Species: Bluetongue virus [TaxId:10900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvp51, d1bvp52
  • Chain '6':
    Compound: bluetongue virus coat protein vp7
    Species: Bluetongue virus [TaxId:10900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvp61, d1bvp62

PDB Chain Sequences:

  • Chain '1':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvp1 (1:)
    mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
    mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
    parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
    pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
    amvqiqvvfyismdktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifp
    pndrdsiltllllstladvytvlrpefaihgvnpmpgpltraiaraayv
    

  • Chain '2':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvp2 (2:)
    mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
    mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
    parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
    pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
    amvqiqvvfyismdktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifp
    pndrdsiltllllstladvytvlrpefaihgvnpmpgpltraiaraayv
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvp3 (3:)
    mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
    mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
    parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
    pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
    amvqiqvvfyismdktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifp
    pndrdsiltllllstladvytvlrpefaihgvnpmpgpltraiaraayv
    

  • Chain '4':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvp4 (4:)
    mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
    mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
    parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
    pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
    amvqiqvvfyismdktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifp
    pndrdsiltllllstladvytvlrpefaihgvnpmpgpltraiaraayv
    

  • Chain '5':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvp5 (5:)
    mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
    mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
    parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
    pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
    amvqiqvvfyismdktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifp
    pndrdsiltllllstladvytvlrpefaihgvnpmpgpltraiaraayv
    

  • Chain '6':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvp6 (6:)
    mdtiaaraltvmracatlqearivleanvmeilgiainryngltlrgvtmrptslaqrne
    mffmcldmmlsaaginvgpispdytqhmatigvlatpeipftteaaneiarvtgetstwg
    parqpygffleteetfqpgrwfmraaqavtavvcgpdmiqvslnagargdvqqifqgrnd
    pmmiylvwrrienfamaqgnsqqtqagvtvsvggvdmragriiawdgqaalhvhnptqqn
    amvqiqvvfyismdktlnqypaltaeifnvysfrdhtwhglrtailnrttlpnmlppifp
    pndrdsiltllllstladvytvlrpefaihgvnpmpgpltraiaraayv