PDB entry 1bvo

View 1bvo on RCSB PDB site
Description: dorsal homologue gambif1 bound to DNA
Class: complex (transcription factor/DNA)
Keywords: TRANSCRIPTION FACTOR, REL PROTEIN, MORPHOGEN, IMMUNITY, DEVELOPMENT, INSECTS, COMPLEX (TRANSCRIPTION FACTOR-DNA), COMPLEX (TRANSCRIPTION FACTOR-DNA) complex
Deposited on 1998-09-16, released 1999-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcription factor gambif1
    Species: Anopheles gambiae [TaxId:7165]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1bvoa_
  • Chain 'D':
    Compound: DNA duplex
  • Chain 'E':
    Compound: DNA duplex
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvoA (A:)
    pyveiteqphpkalrfryecegrsagsipgvnttaeqktfpsiqvhgyrgravvvvscvt
    kegpehkphphnlvgkegckkgvctveinsttmsytfnnlgiqcvkkkdveealrlrqei
    rvdpfrtgfghakepgsidlnavrlcfqvflegqqrgrftepltpvvsdiiydkk
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.