PDB entry 1bvl

View 1bvl on RCSB PDB site
Description: humanized anti-lysozyme fv
Deposited on 1998-09-16, released 1999-02-16
The last revision prior to the SCOP 1.65 freeze date was dated 1999-02-16, with a file datestamp of 1999-02-16.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.22
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1bvla_
  • Chain 'B':
    Domains in SCOP 1.65: d1bvlb_
  • Chain 'C':
    Domains in SCOP 1.65: d1bvlc_
  • Chain 'D':
    Domains in SCOP 1.65: d1bvld_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bvlA (A:)
    qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
    salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvlA (A:)
    qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
    salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvlB (B:)
    diqmtqspsslsasvgdrvtitcrasgnihnylawyqqkpgkapklliyytttladgvps
    rfsgsgsgtdytftisslqpediatyycqhfwstprtfgqgtkveikr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1bvlC (C:)
    qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
    salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvlC (C:)
    qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
    salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvlD (D:)
    diqmtqspsslsasvgdrvtitcrasgnihnylawyqqkpgkapklliyytttladgvps
    rfsgsgsgtdytftisslqpediatyycqhfwstprtfgqgtkveikr