PDB entry 1bvg

View 1bvg on RCSB PDB site
Description: hiv-1 protease-dmp323 complex in solution, nmr minimized average structure
Class: aspartyl protease
Keywords: aids, polyprotein, hydrolase, aspartyl protease, endonuclease, RNA-directed DNA polymerase
Deposited on 1996-01-16, released 1996-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (94)
    Domains in SCOPe 2.01: d1bvga_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered (94)
    Domains in SCOPe 2.01: d1bvgb_
  • Heterogens: DMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvgA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvgB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnf