PDB entry 1bvd

View 1bvd on RCSB PDB site
Description: structure of a biliverdin apomyoglobin complex (form b) at 98 k
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1994-12-16, released 1995-07-31
The last revision prior to the SCOP 1.75 freeze date was dated 1995-07-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.212
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apomyoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1bvda_
  • Heterogens: BLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvdA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg