PDB entry 1bvb

View 1bvb on RCSB PDB site
Description: heme-packing motifs revealed by the crystal structure of cytochrome c554 from nitrosomonas europaea
Class: electron transport
Keywords: cytochrome, electron transport, biological nitrification
Deposited on 1998-09-16, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c-554
    Species: Nitrosomonas europaea [TaxId:915]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bvba_
  • Heterogens: PO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bvbA (A:)
    adapfegrkkcsschkaqaqswkdtahakameslkpnvkkeakqkakldpakdytqdkdc
    vgchvdgfgqkggytiespkpmltgvgceschgpgrnfrgdhrksgqafeksgkktprkd
    lakkgqdfhfeercsachlnyegspwkgakapytpftpevdakytfkfdemvkevkamhe
    hyklegvfegepkfkfhdefqasakpakkgk