PDB entry 1bva

View 1bva on RCSB PDB site
Description: manganese binding mutant in cytochrome c peroxidase
Class: oxidoreductase
Keywords: oxidoreductase, peroxidase, metalloenzyme, protein engineering
Deposited on 1998-09-15, released 1998-12-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.179
AEROSPACI score: -1.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytochrome c peroxidase)
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CCP (MKT)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (Start-293)
      • engineered (36)
      • engineered (43-44)
      • see remark 999 (52)
      • see remark 999 (151)
    Domains in SCOPe 2.06: d1bvaa_
  • Heterogens: MN, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1bvaA (A:)
    mktlvhvasvekgrsyedfqkvynaialklreddeyenyigygddlvrlawhisgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
    hlknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1bvaA (A:)
    lvhvasvekgrsyedfqkvynaialklreddeyenyigygddlvrlawhisgtwdkhdnt
    ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
    ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
    nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
    ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl