PDB entry 1bv9
View 1bv9 on RCSB PDB site
Description: hiv-1 protease (i84v) complexed with xv638 of dupont pharmaceuticals
Class: hydrolase
Keywords: hiv-1 protease (i84v) xv638, hydrolase
Deposited on
1998-09-22, released
1998-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-11-29, with a file datestamp of
2017-11-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein (hiv-1 protease)
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1bv9a_ - Chain 'B':
Compound: protein (hiv-1 protease)
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1bv9b_ - Heterogens: XV6, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1bv9A (A:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1bv9B (B:)
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvnvigrnlltqigctlnf