PDB entry 1bv8

View 1bv8 on RCSB PDB site
Description: receptor domain from alpha-2-macroglobulin
Class: protein binding
Keywords: proteinase, protein binding
Deposited on 1998-09-22, released 1998-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-2-macroglobulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1bv8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1bv8A (A:)
eefpfalgvqtlpqtcdepkahtsfqislsvsytgsrsasnmaivdvkmvsgfiplkptv
kmlersnhvsrtevssnhvliyldkvsnqtlslfftvlqdvpvrdlkpaivkvydyyetd
efaiaeynapcskdlgna